PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM09G14860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 647aa    MW: 69700.7 Da    PI: 6.085
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM09G14860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.17.6e-33447505159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++d k v++tYeg+Hnhe
  OGLUM09G14860.1 447 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHQGCSVRKHVERASHDLKSVITTYEGKHNHE 505
                      59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.9E-37432507IPR003657WRKY domain
SuperFamilySSF1182905.89E-29439507IPR003657WRKY domain
PROSITE profilePS5081137.883442507IPR003657WRKY domain
SMARTSM007743.3E-38447506IPR003657WRKY domain
PfamPF031062.6E-25448505IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    Send to blast
MICERKQSFG GDGPAHLSSD HGSLMEDWMP PPTPSPRTLM SSFLNEDFVS GSFSNIFSDH  60
ESNKPQDQFE RSRELVDLSK EVPSQSARPA FQRDASLDHS LVSPTQRSNS HGGLAERRAA  120
RAGFSVPKID TSRGGSSTVI RSPVAIPPGL SPTTLLESPV FLYNAMAQPS PTTGTLPFLM  180
ASNAKSTIPS ATKMDEDCTF GNDTFSFQPH VGSRRPNFSA AEKGPNACHQ NQSLSNIHQR  240
ESSLQSSFTA VKDITDEKNI KTKTSDSMFG DNHSSDEQDD ETNQNGENSM PPPNHRSGVP  300
LSHTNDPEVN VLENRGSQTC HNSASLWDNA KNDCLQDVQS EVIETRTAAC LPVSTNCDTS  360
IMESQDAVDV SSTLSNEEDD RATHGTASIE CNGDGDETDS KRRKLDALTA ATAAITTTSN  420
IDMGAAASRG VREPRVVVQT TSEVDILDDG YRWRKYGQKV VKGNPNPRSY YKCTHQGCSV  480
RKHVERASHD LKSVITTYEG KHNHEVPAAR NSGHGSSGSG NAPSAPQSNG SQRRQEQGQA  540
SFSQFGGAAP FSSFVLPPRN QFGPSASNFP FGMVPPGMAI PMPSLGSLAP AKMAGHPSTM  600
QGYQGLMIPE GEMKTEPMSQ LGFPAVNPSS SSFQQMMNRP PSFGPQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-33438508878Probable WRKY transcription factor 4
2lex_A1e-33438508878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0650780.0AK065078.1 Oryza sativa Japonica Group cDNA clone:J013001K23, full insert sequence.
GenBankAK1037450.0AK103745.1 Oryza sativa Japonica Group cDNA clone:J033138N11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612221.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_015612220.10.0PREDICTED: probable WRKY transcription factor 2
TrEMBLA0A0E0B4H50.0A0A0E0B4H5_9ORYZ; Uncharacterized protein
STRINGORGLA09G0109100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123382233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26440.15e-55WRKY DNA-binding protein 34